PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DS_DC3C9DC42.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 485aa    MW: 51616.8 Da    PI: 7.4565
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DS_DC3C9DC42.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.48.1e-30203259259
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            dDgynWrKYGqK vkg e+prsYY+Ct+a+Cpvkkkve+sa  +++++i+Y+g+Hnh+
  Traes_4DS_DC3C9DC42.2 203 DDGYNWRKYGQKAVKGGEYPRSYYKCTQASCPVKKKVEHSA-YGQITQIIYRGQHNHQ 259
                            8****************************************.9**************8 PP

2WRKY102.13.1e-32369427159
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC vkk++er+++dp++v++tYeg+H h+
  Traes_4DS_DC3C9DC42.2 369 LDDGYRWRKYGQKVVKGNPHPRSYYKCTYQGCDVKKHIERCSQDPTAVITTYEGKHSHD 427
                            59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.5E-27194261IPR003657WRKY domain
SuperFamilySSF1182908.76E-24200261IPR003657WRKY domain
SMARTSM007743.5E-30202260IPR003657WRKY domain
PROSITE profilePS5081122.814203261IPR003657WRKY domain
PfamPF031061.2E-22203259IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.4E-36356429IPR003657WRKY domain
SuperFamilySSF1182902.09E-29361429IPR003657WRKY domain
PROSITE profilePS5081136.173364429IPR003657WRKY domain
SMARTSM007745.8E-38369428IPR003657WRKY domain
PfamPF031065.9E-25370427IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MAAHEASAGG GEGARCTPPR PALSLPPRSA VESFFGSGAT AASFAETSPG PFTLAAALFP  60
DMPSSAFHGS FTQLLVGAMG SPAAPPSPPS PFAVPPGLSP TALVGPFPPT GNFEMSHQQA  120
LAQVTAQAVH SQYTVGSQAD YSLPFSSATT SALTSQFINS SANVTSMKET ATLPLHTVND  180
NLKSNEVSQG FQTSALTVDK PADDGYNWRK YGQKAVKGGE YPRSYYKCTQ ASCPVKKKVE  240
HSAYGQITQI IYRGQHNHQR PPKRRSKDGG NLLNEDDFPE NRDTLTRSEP GSQDHSGKVE  300
VSNDGITGSS ISKRRDGGDQ SSGSSDREED NDEAGDDNGD AGIVNANKRH VPAPAQRIIV  360
QTTSEIDLLD DGYRWRKYGQ KVVKGNPHPR SYYKCTYQGC DVKKHIERCS QDPTAVITTY  420
EGKHSHDVPA ARSSVAAAAS ANASSSISLL HRGQKAASSS QRVLPRAALH TSDSSLQLKE  480
ENEIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-37188430578Probable WRKY transcription factor 4
2lex_A6e-37188430578Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1259264RPPKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2500890.0AK250089.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf63p16, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233399.10.0PREDICTED: probable WRKY transcription factor 4
RefseqXP_003559732.10.0PREDICTED: probable WRKY transcription factor 4
SwissprotQ9XI901e-106WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLA0A096URP60.0A0A096URP6_WHEAT; Uncharacterized protein
STRINGMLOC_31894.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-73WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]